Hello and welcome to our community! Is this your first visit?
Register
Enjoy an ad free experience by logging in. Not a member yet? Register.
Results 1 to 2 of 2
  1. #1
    New to the CF scene
    Join Date
    Apr 2009
    Posts
    9
    Thanks
    1
    Thanked 0 Times in 0 Posts

    parsing script for MSA

    Hi,

    I need help writing a script in Perl to parse the following type of sequence alignment from a FASTA file, residue by residue to compare each position:

    MVATFNPAVGSHVWVEDPDEAWLDGEVVEINGDQIKVLCASGKQVVVKDSNIYPKDVEAP
    MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYHLDPKTKELP

    Can anyone help?

    Thanks

  • #2
    New Coder
    Join Date
    Mar 2009
    Location
    Fabric Covered Box
    Posts
    69
    Thanks
    1
    Thanked 16 Times in 14 Posts
    BioPerl is what you need.


  •  

    Posting Permissions

    • You may not post new threads
    • You may not post replies
    • You may not post attachments
    • You may not edit your posts
    •