...

View Full Version : parsing script for MSA



roro
04-14-2009, 06:48 PM
Hi,

I need help writing a script in Perl to parse the following type of sequence alignment from a FASTA file, residue by residue to compare each position:

MVATFNPAVGSHVWVEDPDEAWLDGEVVEINGDQIKVLCASGKQVVVKDSNIYPKDVEAP
MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYHLDPKTKELP

Can anyone help?

Thanks

Shannon Blonk
04-14-2009, 09:08 PM
BioPerl (http://www.bioperl.org/wiki/Main_Page) is what you need.



EZ Archive Ads Plugin for vBulletin Copyright 2006 Computer Help Forum